PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 155aa    MW: 17285.6 Da    PI: 10.0984
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101451.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-3947105260
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                     ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k+
  XP_011101451.1  47 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKQ 105
                     68999***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3046104IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3249105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42551105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MAEVQQSNNS SSGIKLFGAT ISLKESSKAN NDRQEPRKSD QTVDKRPDKI IPCPRCKSME  60
TKFCYFNNYN VNQPRHFCKG CQRYWTAGGA LRNVPVGAGR RKTKQLYRGL SQAAAGCLFD  120
ASAAGVKQLD FDAVEEWQAA EHLFMAKRRR CASSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101451.11e-114PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683501e-53DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLM5X2T03e-62M5X2T0_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g01260.t016e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.16e-55Dof family protein